Loading...
Statistics
Advertisement

CC Service Transformer
www.cst-cctr.com/

Cst-cctr.com

Advertisement
Conversion Technology Metas Server
Cst-cctr.com is hosted in Thailand / Bangkok . Cst-cctr.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 0. Its server type is: Apache/2.4.18 (Unix) OpenSSL/0.9.8e-fips-rhel5 PHP/5.3.29.

Technologies in use by Cst-cctr.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 0

Server Type

  • Apache/2.4.18 (Unix) OpenSSL/0.9.8e-fips-rhel5 PHP/5.3.29

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cst-cctr.com

Missing HTTPS protocol.

    Meta - Cst-cctr.com

    Number of occurences: 3
    • Name: author
      Content: CC Service Transformer
    • Name:
      Content: text/html; charset=utf-8
    • Name: stats-in-th
      Content: b715

    Server / Hosting

    • IP: 27.254.81.146
    • Latitude: 13.75
    • Longitude: 100.50
    • Country: Thailand
    • City: Bangkok

    Rname

    • ns5.hosttook.com
    • ns6.hosttook.com
    • mail.cst-cctr.com

    Target

    • hostmaster.cst-cctr.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 21 Sep 2016 00:43:17 GMT Server: Apache/2.4.18 (Unix) OpenSSL/0.9.8e-fips-rhel5 PHP/5.3.29 Last-Modified: Tue, 20 Sep 2016 02:37:10 GMT ETag: "108a-53ce74e296180" Accept-Ranges: bytes Content-Length: 4234 Vary: Accept-Encoding,User-Agent Content-Type: text/html X-Cache: MISS from s_hv897 Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

    DNS

    host: cst-cctr.com
    1. class: IN
    2. ttl: 14400
    3. type: A
    4. ip: 27.254.81.146
    host: cst-cctr.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns5.hosttook.com
    host: cst-cctr.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns6.hosttook.com
    host: cst-cctr.com
    1. class: IN
    2. ttl: 14400
    3. type: SOA
    4. mname: ns5.hosttook.com
    5. rname: hostmaster.cst-cctr.com
    6. serial: 2016021700
    7. refresh: 14400
    8. retry: 3600
    9. expire: 1209600
    10. minimum-ttl: 86400
    host: cst-cctr.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 10
    5. target: mail.cst-cctr.com
    host: cst-cctr.com
    1. class: IN
    2. ttl: 14400
    3. type: TXT
    4. txt: v=spf1 a mx ip4:27.254.81.146 ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.st-cctr.com, www.cdst-cctr.com, www.dst-cctr.com, www.crst-cctr.com, www.rst-cctr.com, www.ctst-cctr.com, www.tst-cctr.com, www.cvst-cctr.com, www.vst-cctr.com, www.cfst-cctr.com, www.fst-cctr.com, www.cgst-cctr.com, www.gst-cctr.com, www.chst-cctr.com, www.hst-cctr.com, www.cnst-cctr.com, www.nst-cctr.com, www.cmst-cctr.com, www.mst-cctr.com, www.cjst-cctr.com, www.jst-cctr.com, www.ct-cctr.com, www.cset-cctr.com, www.cet-cctr.com, www.cswt-cctr.com, www.cwt-cctr.com, www.csdt-cctr.com, www.cdt-cctr.com, www.csxt-cctr.com, www.cxt-cctr.com, www.csft-cctr.com, www.cft-cctr.com, www.csgt-cctr.com, www.cgt-cctr.com, www.cstt-cctr.com, www.ctt-cctr.com, www.cs-cctr.com, www.cstq-cctr.com, www.csq-cctr.com, www.csta-cctr.com, www.csa-cctr.com, www.cst -cctr.com, www.cs -cctr.com, www.cstw-cctr.com, www.csw-cctr.com, www.cste-cctr.com, www.cse-cctr.com, www.cstz-cctr.com, www.csz-cctr.com, www.cstx-cctr.com, www.csx-cctr.com, www.cstc-cctr.com, www.csc-cctr.com, www.cstcctr.com, www.cst-tcctr.com, www.csttcctr.com, www.cst-gcctr.com, www.cstgcctr.com, www.cst-hcctr.com, www.csthcctr.com, www.cst-ucctr.com, www.cstucctr.com, www.cst-jcctr.com, www.cstjcctr.com, www.cst-xcctr.com, www.cstxcctr.com, www.cst-scctr.com, www.cstscctr.com, www.cst-acctr.com, www.cstacctr.com, www.cst-cctr.com, www.cstcctr.com, www.cst- cctr.com, www.cst cctr.com, www.cst-ctr.com, www.cst-cdctr.com, www.cst-dctr.com, www.cst-crctr.com, www.cst-rctr.com, www.cst-ctctr.com, www.cst-tctr.com, www.cst-cvctr.com, www.cst-vctr.com, www.cst-cfctr.com, www.cst-fctr.com, www.cst-cgctr.com, www.cst-gctr.com, www.cst-chctr.com, www.cst-hctr.com, www.cst-cnctr.com, www.cst-nctr.com, www.cst-cmctr.com, www.cst-mctr.com, www.cst-cjctr.com, www.cst-jctr.com, www.cst-ctr.com, www.cst-ccdtr.com, www.cst-cdtr.com, www.cst-ccrtr.com, www.cst-crtr.com, www.cst-ccttr.com, www.cst-cttr.com, www.cst-ccvtr.com, www.cst-cvtr.com, www.cst-ccftr.com, www.cst-cftr.com, www.cst-ccgtr.com, www.cst-cgtr.com, www.cst-cchtr.com, www.cst-chtr.com, www.cst-ccntr.com, www.cst-cntr.com, www.cst-ccmtr.com, www.cst-cmtr.com, www.cst-ccjtr.com, www.cst-cjtr.com, www.cst-ccr.com, www.cst-cctqr.com, www.cst-ccqr.com, www.cst-cctar.com, www.cst-ccar.com, www.cst-cct r.com, www.cst-cc r.com, www.cst-cctwr.com, www.cst-ccwr.com, www.cst-ccter.com, www.cst-ccer.com, www.cst-cctzr.com, www.cst-cczr.com, www.cst-cctxr.com, www.cst-ccxr.com, www.cst-cctcr.com, www.cst-cccr.com, www.cst-cct.com, www.cst-cctri.com, www.cst-ccti.com, www.cst-cctro.com, www.cst-ccto.com, www.cst-cctrl.com, www.cst-cctl.com, www.cst-cctrl.com, www.cst-cctl.com, www.cst-cctr..com, www.cst-cct..com,

    Other websites we recently analyzed

    1. hrprofession.co
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    2. Easton Sports Group
      Houston (United States) - 192.185.138.32
      Server software: nginx/1.10.0
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, Wordpress
      Number of Javascript: 11
      Number of meta tags: 2
    3. meada.com
      Switzerland - 141.8.224.25
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    4. melonella.com
      Dublin (Ireland) - 46.137.111.230
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html
    5. Klettertreff.org
      Herzfond
      Austria - 84.116.32.65
      Server software: Apache
      Technology: Html
      Number of meta tags: 4
    6. kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    7. www.aarhusdesignbureau.dk
      Denmark - 77.66.85.131
      Server software: Apache-Coyote/1.1
      Technology: Html
      Number of meta tags: 1
    8. CNC-Bertschinger AG - Präzisionsmechanik
      Jules Bertschinger AG, Präzisionsmechanik, CNC-Bearbeitung, Werkzeug- und Formenbau
      Switzerland - 217.196.177.100
      Server software: nginx
      Technology: Html, Javascript, jQuery UI, Php, Xoops
      Number of Javascript: 9
      Number of meta tags: 8
    9. Riverside Haj
      Riverside Haj
      San Francisco (United States) - 192.241.212.155
      G Analytics ID: UA-51322866-1
      Server software: nginx/1.4.6 (Ubuntu)
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, jQuery, Google Analytics
      Number of Javascript: 13
      Number of meta tags: 5
    10. www.newrf.ru/ - Сервис регистрации доменов и хостинга *.RU-TLD.RU
      France - 37.187.83.72
      Server software: nginx
      Technology: CSS, Google Font API, Html, Javascript, Shortcodes, Yandex.Metrika, Wordpress
      Number of Javascript: 1
      Number of meta tags: 1

    Check Other Websites